CDS

Accession Number TCMCG080C40943
gbkey CDS
Protein Id XP_027912725.1
Location join(78472..78640,78772..78842)
Gene LOC114172447
GeneID 114172447
Organism Vigna unguiculata

Protein

Length 79aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA521068
db_source XM_028056924.1
Definition elongation factor Tu, mitochondrial-like [Vigna unguiculata]

EGGNOG-MAPPER Annotation

COG_category J
Description This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko03012        [VIEW IN KEGG]
ko03029        [VIEW IN KEGG]
ko04147        [VIEW IN KEGG]
KEGG_ko ko:K02358        [VIEW IN KEGG]
EC -
KEGG_Pathway -
GOs GO:0000166        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005524        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005618        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005739        [VIEW IN EMBL-EBI]
GO:0008144        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008270        [VIEW IN EMBL-EBI]
GO:0010035        [VIEW IN EMBL-EBI]
GO:0010038        [VIEW IN EMBL-EBI]
GO:0017076        [VIEW IN EMBL-EBI]
GO:0030312        [VIEW IN EMBL-EBI]
GO:0030554        [VIEW IN EMBL-EBI]
GO:0032553        [VIEW IN EMBL-EBI]
GO:0032555        [VIEW IN EMBL-EBI]
GO:0032559        [VIEW IN EMBL-EBI]
GO:0035639        [VIEW IN EMBL-EBI]
GO:0036094        [VIEW IN EMBL-EBI]
GO:0042221        [VIEW IN EMBL-EBI]
GO:0043167        [VIEW IN EMBL-EBI]
GO:0043168        [VIEW IN EMBL-EBI]
GO:0043169        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046686        [VIEW IN EMBL-EBI]
GO:0046872        [VIEW IN EMBL-EBI]
GO:0046914        [VIEW IN EMBL-EBI]
GO:0050896        [VIEW IN EMBL-EBI]
GO:0050897        [VIEW IN EMBL-EBI]
GO:0071944        [VIEW IN EMBL-EBI]
GO:0097159        [VIEW IN EMBL-EBI]
GO:0097367        [VIEW IN EMBL-EBI]
GO:1901265        [VIEW IN EMBL-EBI]
GO:1901363        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGAGGGTGCCGACACCCGCTTTCTTCTCTAACTACAGACCCCAGTTTTACTTGAGGACAGCTGATATCACTGGAAAAGTAGAGTTGCCTGAAAATGTTAAGATGGTTATGCCCGGAGACAACGTTACTGCTGTGTTTGAATTGATTTCAGCAGTTCCACTTGAAGCAGGACAAAGATTTGCCTTGAGAGAAGGCGGCAGAACAGTTGGTGCAGGTGTGGTGTCAAAAGTACTGAGCTAG
Protein:  
MRVPTPAFFSNYRPQFYLRTADITGKVELPENVKMVMPGDNVTAVFELISAVPLEAGQRFALREGGRTVGAGVVSKVLS